ATR3

===General Information===

BAC Information: AC009755, F14P3.7, 17222-21235

protein type: diflavin reductase (ATR3 encodes a diflavin reductase essential for Arabidopsis embryo development Varadarajan J, Guilleminot J, Saint-Jore-Dupas C, Piégu B, Chabouté ME, Gomord V, Coolbaugh RC, Devic M, Delorme V. New Phytol. 2010 Jul;187(1):67-82. Epub 2010 Apr 12.)

Length: 616

Locus: At3g02280

Note: As per Varadarajan et al., this gene is not a CPR and has been removed from our alignments and phylogenetic trees accordingly.

===Amino Acid Sequence===

MGEKQRKLLVLYASQTGNALDAAERIGREAERRGLPASVVSTDEFDTEAVVFVVSTTGQG
DSPDSFKAFWRFLLQRNLGNYWLQQVRYAVFGLGDSGYQKYNFVAKKLDKRLSDLGATTI
IEKGLGDDQHPSGYEGTLDPWMLSLWRTLYQINPKYFPKGPDVKIPQDEVIDKPKYRILF
HKQEKLEPKLLSDSDIIQRARGMSPGKLFKDKSKPDCFLKMTRNEVLTKAESTKDVRHFE
FQFVSSTIEYEVGDVVELLPSQNSSVVDAFIERCGLDPESFITVGPRETENSSFSEEMIT
QIPIKLKTFVELTMDVTSASPRRYFFEIMSFYATAEHEKERLQYFASPEGRDDLYNYNQK
ERRSILEVLEDFPSVQIPFDWLVQLVPPLKPRAFSISSSPLAHPAAVHLTVSIVSWITPY
KRTRKGLCSSWLASLAPEQEVNIPVWFHKGSLPAPSQSLPLILVGPGTGCAPFRGFIAER
AVQAQSSPVAPVMFFFGCRNKDTDFLYRDFWESHAREGGMLSEGKGGGFYTAFSRDQPKK
VYVQHKIREMSKRVWDLLCDGAAVYVAGSSTKMPCDVMSAFEDIVSEETGGGSKEVASRW
LKALEKTGRYNVEAWS

===Genomic Sequence===

Taken from BAC AC009755

TTAAGACCAAGCTTCAACATTGTACCTCCCTGTCTTCTCCAAAGCCTTAAGCCACCGTGA
AGCTACCTCCTTTGATCCTCCTCCTGTCTCCTCCGACACAATATCTTCGAAAGCCGACAT
CACATCACAAGGCATTTTCGTCGACGAGCCCGCCACGTAAACAGCGGCTCCATCACAGAG
TAAATCCCAAACTCTCTTGCTCATTTCGCGGATCTTATGTTGCACGTAAACCTTCTTTGG
TTGGTCTCTAGAGAACGCTGTGTAAAAGCCACCGCCTTTTCCTTCAGAGAGCATGCCTCC
TTCTCTTGCGTGAGACTCCCAGAAATCGCGGTATAGAAAGTCTGTGTCTTTGTTTCTGCA
ACCAAAGAAGAACATGACGGGGGCAACCGGGCTAGACTGAGCTTGTACGGCTCTCTCAGC
TATGAATCCACGGAATGGCGCACATCCGGTTCCGGGTCCCACTAAGATGAGCGGAAGCGA
CTGAGATGGAGCAGGAAGGGAGCCTTTGTGAAACCAAACCGGTATGTTTACCTCTAACCA
CAACCGAAGACAAAGAAAACATATCAGAAATAGAGAACTGAGCCATTCACAGTTATGGTA
AAGAAGAAACAAACTTCTAACCTTGTTCAGGTGCGAGGCTTGCAAGCCAAGAGGAGCACA
GACCTTTCCGAGTTCTCTTATAAGGCGTGATCCATGATACTATGCTTACAGTCAAATGTA
CTGCGGCAGGGTGGGCCAAAGGAGACGAAGATATCGAAAAAGCTCTTGGTTTTAGCGGTG
GGACTAACTGTACTAGCCAATCAAAAGGGATTTGTACGGAAGGAAAATCCTCTAGCACCT
ACATAGGCATTAGCAATACGATTGGTTAAGAGAGTGAATGCATATTCAAGACGAATCATG
AACCTGTGAGATCTGGTGCTATTTTACCTCAAGAATGCTTCTTCTTTCCTTCTGATTGTA
ATTGTAGAGATCATCCCGCCCCTCGGGTGAGGCAAAGTATTGAAGTCTTTCCTTCTCATG
TTCAGCTGTTGCATAGAAGCTCATAATCTGAACAGAGATGATACATCATACATTACAAGG
GTGTCCATCAAATACTTGTCTCATAAAACTCAAAGGACTTTCATAGATTTGAAATTCAAA
TGCATTAGAACTGAATGATTGAAATTAAAGGGTTCTTACCTCAAAGAAGTATCGTCGAGG
TGAAGCGGATGTAACATCCATTGTTAATTCAACAAAAGTCTTAAGCTTAATAGGGATCTG
TGTAATCATTTCTTCACTAAAACTACTATTCTCTGTCTCTCGCGGACCAACCTGAAAAAA
AAAATAACTCTCGGGATTTATTTTGAATAACAATCTGAGATAATTTTATATCACAAGAGT
GGAGCTACTTACTGTAATGAATGATTCTGGGTCTAAACCGCAGCGTTCTATAAACGCATC
TACCACTGAAGAATTTTGGCTTGGAAGAAGCTCAACAACATCGCCAACTTCATATTCGAT
AGTCTTAAAAGAGTAGAAAACCAAAGAGGATAATAAGAAATCACCCTCAAAATCGACTGA
ACTTTGACCTAAGTAAGTGACAGCAAAGTACTTACAGAAGAAACAAACTGGAACTCAAAG
TGGCGGACATCCTTTGTGCTTTCAGCTTTAGTCAAGACTTCATTGCGGGTCTACATGATT
AGAATGTTAAGGCAAGCTAAGGGAATAAACCTCATATCATCTAGGCTTAGCATAATAATG
CATACCAAAAGGCAAAATCAGATATTTTAAGAAAACATGTTAATCATCAAGCAACACACC
AGATTCAAGGTAACAGAGGACTGGAATAGCATAACCAGTGAGGTTGACTAGCATATCAGA
ATGAAAAAGAAAAGGAATTTTTTGTTGGGCAACAGGATGAGCATACCATCTTGAGAAAGC
AGTCTGGTTTACTTTTGTCCTTGAATAATTTTCCTGGGGACATTCCACGGGCTCTTTGTA
TGATATCTGCAAAAACATAAGAGGCATATTAAACAAGATAAATTCCCAAAAACATGTAAT
ATGGTACCTAACCTTTTTCATGATGCAAGAGAAATTAGTTTCACGAGCCAATTGAAACAT
AACATTTGTGAGCCTACTTCCAGCAGATTCATTCAAAATGATTTTTATACCAACATTTCT
AGCAATTACCATTAGCAAGTAGGCAATTCAATGTTAAGTAGCACAACATAGTCATAAATT
AACATAAATGAAGCCAAGTATCCACTCAATAATTTTGGCATACCTGAATCTGACAATAAT
TTAGGCTCCAATTTCTCCTGCTTATGAAATAAAATCCTATATTTAGGCTTATCAATTACT
TCATCTTGAGGAATTTTCACATCTGGACCTTTAGGAAAGTATTTTGGATTGATCTGATAT
AATGTCCTCCACAAAGAAAGCATCCACGGATCAAGAGTTCCTTCATACCTGAAAATAAAG
AAAACACCAAAACTGAAAACTTAGTATCCTAACACTGGACTAATAAAACTACAGTAAGAA
TGTAGATACAACTGACTGATCAAATGGTTCCTTCATATCTGAAAATAAAGAAAACACCAA
AACTGAAAACTTAGTATTCTAACACTGGACTTTATAGTAGTATACCAGGAACAGTAAGAA
TGTGGATACAATATCTTCAACTGACCAAATGGTTCATCTGATTTCAAAGAATATTATGTA
AAAGCAGGATTCTTTATTTGTTTTAATATACCGTATCATACCCTGATGGGTGTTGATCAT
CTCCTAGACCTTTTTCAATGATGGTTGTGGCCCCAAGATCTGATAATCTTTTGTCTAGCT
TCTTTGCTACAAACTAAAGCCATCAGAAAGAGAATCATGTCATGAATTTGTGCCACAGAA
GAATAAATCAGACAAATCTCACGATTTCTGGCAGTGAGGATTCTTTTACAAAAATAAAAA
ACCCTGAATAGAAAGGAGAAGGGTAAGTTTGCTAATATCATTCTTCCTTAGTAAAGCCTA
GTTTTTTCTTCTCACATTGATTAAAACATCAAAAAAAATGTGGAGGAACTTGGGAATAGC
CCAACATGGGGAATGTTAAAACAAAGCGAAACTGAATATAAATCATGTCATGAATTTGTG
CCACAGAGAATAAATCATCCCACGATTTCTGGCAATGAGGATTCTTTTTACAAAAAGAAA
TAACCCTGAATAGAAAGGAAAGTTTGCTAATATCATTCTTCCTTAGTAAAGCCTAGTTTT
TTCTTCTCACATTGATGAATAGATTAAAACAAAACTGGAGAAACTTGGGAATAACGAAAC
ATGTGGAATGTTAAAACAAAGTGAAACTGAATATAAAGAGGCAGAAGAACTTACGTTGTA
CTTCTGGTAACCAGAATCACCTAGTCCAAACACTGCATAGCGAACTTGTTGCAACCAATA
GTTTCCCAGATTTCTTTGAAGAAGAAACCTCCAAAATGCCTTGAATGATTGAAAAAGACA
ATGAACAATAATAAGCTACGATTAATTAAAAGCGTTTTACAGGAATAAACTAATTGGTAA
CAAATTTCAGGACTTTAAACGAACCTTAAAGGAATCAGGAGAGTCTCCTTGCCCTGTAGT
GGAGACAACAAAAACAACAGCCTCCTCATGATGAGGTAAGGAACTCTGCAGAAAACAACA
CATGATAAAAAGGAAAACACTTTTATGTCGAGAGTTTGCGCTAACAGCTGATTATTGGCG
AGGGGAAAACATATCAGCAATCAACAATTTTTGCAATTGAAAGGGGTTTGCTTCCAAAAC
ATATTAGCAATCATCATATAAAAACGAAGCAAACCATCTTCCAAAACAAAGTAACGAGCT
TTTAAAATCAAATTGGTTTTACTACACACATACCGTGTCGAATTCGTCGGTGGAGACGAC
AGAAGCTGGCAGTCCACGGCGTTCTGCTTCGCGGCCAATACGCTCCGCCGCATCAAGAGC
GTTTCCGGTCTGAGAGGCATACAACACAAGCAGCTTCCTTTGTTTTTCTCCCAT

===cDNAs===

Deduced from genomic sequence:

ATGGGAGAAAAACAAAGGAAGCTGCTTGTGTTGTATGCCTCTCAGACCGGAAACGCTCTT
GATGCGGCGGAGCGTATTGGCCGCGAAGCAGAACGCCGTGGACTGCCAGCTTCTGTCGTC
TCCACCGACGAATTCGACACGGAGGCTGTTGTTTTTGTTGTCTCCACTACAGGGCAAGGA
GACTCTCCTGATTCCTTTAAGGCATTTTGGAGGTTTCTTCTTCAAAGAAATCTGGGAAAC
TATTGGTTGCAACAAGTTCGCTATGCAGTGTTTGGACTAGGTGATTCTGGTTACCAGAAG
TACAACTTTGTAGCAAAGAAGCTAGACAAAAGATTATCAGATCTTGGGGCCACAACCATC
ATTGAAAAAGGTCTAGGAGATGATCAACACCCATCAGGGTATGAAGGAACTCTTGATCCG
TGGATGCTTTCTTTGTGGAGGACATTATATCAGATCAATCCAAAATACTTTCCTAAAGGT
CCAGATGTGAAAATTCCTCAAGATGAAGTAATTGATAAGCCTAAATATAGGATTTTATTT
CATAAGCAGGAGAAATTGGAGCCTAAATTATTGTCAGATTCAGATATCATACAAAGAGCC
CGTGGAATGTCCCCAGGAAAATTATTCAAGGACAAAAGTAAACCAGACTGCTTTCTCAAG
ATGACCCGCAATGAAGTCTTGACTAAAGCTGAAAGCACAAAGGATGTCCGCCACTTTGAG
TTCCAGTTTGTTTCTTCTACTATCGAATATGAAGTTGGCGATGTTGTTGAGCTTCTTCCA
AGCCAAAATTCTTCAGTGGTAGATGCGTTTATAGAACGCTGCGGTTTAGACCCAGAATCA
TTCATTACAGTTGGTCCGCGAGAGACAGAGAATAGTAGTTTTAGTGAAGAAATGATTACA
CAGATCCCTATTAAGCTTAAGACTTTTGTTGAATTAACAATGGATGTTACATCCGCTTCA
CCTCGACGATACTTCTTTGAGATTATGAGCTTCTATGCAACAGCTGAACATGAGAAGGAA
AGACTTCAATACTTTGCCTCACCCGAGGGGCGGGATGATCTCTACAATTACAATCAGAAG
GAAAGAAGAAGCATTCTTGAGGTGCTAGAGGATTTTCCTTCCGTACAAATCCCTTTTGAT
TGGCTAGTACAGTTAGTCCCACCGCTAAAACCAAGAGCTTTTTCGATATCTTCGTCTCCT
TTGGCCCACCCTGCCGCAGTACATTTGACTGTAAGCATAGTATCATGGATCACGCCTTAT
AAGAGAACTCGGAAAGGTCTGTGCTCCTCTTGGCTTGCAAGCCTCGCACCTGAACAAGAG
GTAAACATACCGGTTTGGTTTCACAAAGGCTCCCTTCCTGCTCCATCTCAGTCGCTTCCG
CTCATCTTAGTGGGACCCGGAACCGGATGTGCGCCATTCCGTGGATTCATAGCTGAGAGA
GCCGTACAAGCTCAGTCTAGCCCGGTTGCCCCCGTCATGTTCTTCTTTGGTTGCAGAAAC
AAAGACACAGACTTTCTATACCGCGATTTCTGGGAGTCTCACGCAAGAGAAGGAGGCATG
CTCTCTGAAGGAAAAGGCGGTGGCTTTTACACAGCGTTCTCTAGAGACCAACCAAAGAAG
GTTTACGTGCAACATAAGATCCGCGAAATGAGCAAGAGAGTTTGGGATTTACTCTGTGAT
GGAGCCGCTGTTTACGTGGCGGGCTCGTCGACGAAAATGCCTTGTGATGTGATGTCGGCT
TTCGAAGATATTGTGTCGGAGGAGACAGGAGGAGGATCAAAGGAGGTAGCTTCACGGTGG
CTTAAGGCTTTGGAGAAGACAGGGAGGTACAATGTTGAAGCTTGGTCTTAA

===ESTs===

GenBank Accession: AV557040, AV534272


Reductase position on Chromosome 3.


Go back to the list of P450-related genes.