ATR2

===General Information===

BAC Information: AL161576, 136551-140229

protein type: NADPH cytochrome P450 reductase

Length:

Locus: At4g30210

===Amino Acid Sequence===

MSSSSSSSTSMIDLMAAIIKGEPVIVSDPANASAYESVAAELSSMLIENRQFAMIVTTSI
AVLIGCIVMLVWRRSGSGNSKRVEPLKPLVIKPREEEIDDGRKKVTIFFGTQTGTAEGFA
KALGEEAKARYEKTRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAARF
YKWFTEGNDRGEWLKNLKYGVFGLGNRQYEHFNKVAKVVDDILVEQGAQRLVQVGLGDDD
QCIEDDFTAWREALWPELDTILREEGDTAVATPYTAAVLEYRVSIHDSEDAKFNDITLAN
GNGYTVFDAQHPYKANVAVKRELHTPESDRSCIHLEFDIAGSGLTMKLGDHVGVLCDNLS
ETVDEALRLLDMSPDTYFSLHAEKEDGTPISSSLPPPFPPCNLRTALTRYACLLSSPKKS
ALVALAAHASDPTEAERLKHLASPAGKDEYSKWVVESQRSLLEVMAEFPSAKPPLGVFFA
GVAPRLQPRFYSISSSPKIAETRIHVTCALVYEKMPTGRIHKGVCSTWMKNAVPYEKSEK
LFLGRPIFVRQSNFKLPSDSKVPIIMIGPGTGLAPFRGFLQERLALVESGVELGPSVLFF
GCRNRRMDFIYEEELQRFVESGALAELSVAFSREGPTKEYVQHKMMDKASDIWNMISQGA
YLYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGFVKNLQTSGRYLRDVW

===Genomic Sequence===

Taken from BAC AL161576

ATGTCCTCTTCTTCTTCTTCGTCAACCTCCATGATCGATCTCATGGCAGCAATCATCAAA
GGAGAGCCTGTAATTGTCTCCGACCCAGCTAATGCCTCCGCTTACGAGTCCGTAGCTGCT
GAATTATCCTCTATGCTTATAGAGAATCGTCAATTCGCCATGATTGTTACCACTTCCATT
GCTGTTCTTATTGGTTGCATCGTTATGCTCGTTTGGAGGAGATCCGGTTCTGGGAATTCA
AAACGTGTCGAGCCTCTTAAGCCTTTGGTTATTAAGCCTCGTGAGGAAGAGATTGATGAT
GGGCGTAAGAAAGTTACCATCTTTTTCGGTACACAAACTGGTACTGCTGAAGGTTTTGCA
AAGGTGAGGACTTTGTGTTTTGGTTTGTTCTGATTTCGAATGATGAAGTTGAATTTGAAT
CAGTTTGATGTTTTTGAAATTTGCAGGCTTTAGGAGAAGAAGCTAAAGCAAGATATGAAA
AGACCAGATTCAAAATCGTTGATTTGGTATTTATTTTGTTCCATCAACTTTTTAGATAAA
GTTTGATGCTTTAAGTATAATCTGATTCTGAGTTTATTAACAGGATGATTACGCGGCTGA
TGATGATGAGTATGAGGAGAAATTGAAGAAAGAGGATGTGGCTTTCTTCTTCTTAGCCAC
GTTAGTTTTCTTAGCTGATCTTTTGTTTGGGATCGGTATAAGTATTAAATTTGATTTGTT
CTTGTGGCTGACTTGGTTTTACTATCTGGAATCTGGATGTAGATATGGAGATGGTGAGCC
TACCGACAATGCAGCGAGATTCTACAAATGGTTCACCGAGGTTAGTCTTTTTTTTTGGCT
TGGCTCAACTAGTTGTTGTAACGTGTGTTGTTTTTGTTTTCTTGTTTCTGAAGTTGTAAA
CATGTGTTTACAGGGGAATGACAGAGGAGAATGGCTTAAGAACTTGAAGTATGGAGTGTT
TGGATTAGGAAACAGACAATATGAGCATTTTAATAAGGTTTATAAATGAAATCTTTATTC
CCCTTTTCTTAATGGTTTTGCTCTTGTCACTATTATGGTCTCCTTCCAATTACTTTGGAC
CGAGCTAATATGCAGATTTGTTTTGTAAATTTTGGGTTGCAGGTTGCCAAAGTTGTAGAT
GACATTCTTGTCGAACAAGGTTTGTTTTGTTTCTTTCTTTCTTTCTTTCTTTCATCATCC
GTTTTGGATCGCTCTGATCCGGTCTTAATGTGTTGTATTTTGGTTTCTAACTTCATTGAG
TGGGTTGTTCAGGTGCACAGCGTCTTGTACAAGTTGGTCTTGGAGATGATGACCAGTGTA
TTGAAGATGACTTTACCGCTTGGTATTTTACATTTCCACTTCTCGTGGCTTATCGTGTAC
AATGCTGTTTTGGTCATTTGTTTTTTGGGGGGCTAAATTTGCTACCTCTTGCAGGCGAGA
AGCATTGTGGCCCGAGCTTGATACAATACTGAGGGAAGAAGGGGATACAGCTGTTGCCAC
ACCATACACTGCAGCTGTGTTAGAATACAGAGTTTCTATTCACGACTCTGAAGATGCCAA
ATTCAATGATATAAACATGGCAAATGGGAATGGTTACACTGTGTTTGATGCTCAACATCC
TTACAAGTACAAAATCCAGCCGCTTCTTTTCTTTTTCCTTATAATCTTGTCTTGTTACTT
GATCTAATCTTGCTTTTTTTGGCTTTTAAAGAGCAAATGTCGCTGTTAAAAGGGAGCTTC
ATACTCCCGAGTCTGATCGTTCTTGTATCCATTTGGAATTTGACATTGCTGGAAGTGGAC
TTACGTGAGTTCTACTGCTATATGAATATTTACTTAATCAGAGGGAAATATTATTGGAGA
ATAACATGAATGTATTTTTTGTATCTTGTCTGTCAGGTATGAAACTGGAGATCATGTTGG
TGTACTTTGTGATAACTTAAGTGAAACTGTAGATGAAGCTCTTAGATTGCTGGATATGTC
ACCTGATACTTATTTCTCACTTCACGCTGAAAAAGAAGACGGCACACCAATCAGCAGCTC
ACTGCCTCCTCCCTTCCCACCTTGCAACTTGAGAACAGCGCTTACACGATATGCATGTCT
TTTGAGTTCTCCAAAGAAGGTTGGTTGGATTCATTTACCATTAGACTGGTTATAATCAGT
TTTGTTTCTCTTCATAGAGATTCAAACTCAATTATTTTCATGTTTATTTTCTTGCAGTCT
GCTTTAGTTGCGTTGGCTGCTCATGCATCTGATCCTACCGAAGCAGAACGATTAAAACAC
CTTGCTTCACCTGCTGGAAAGGTTGTGGCTGAACCTTTTGTTGGTTTCTACTCTTCATTT
TCCATTTCTTTAAAATGGAATCTGACAATGTATATTTTGTGTCCTTTCAACAACAGGATG
AATATTCAAAGTGGGTAGTAGAGAGTCAAAGAAGTCTACTTGAGGTGATGGCCGAGTTTC
CTTCAGCCAAGCCACCACTTGGTGTCTTCTTCGCTGGAGTTGCTCCAAGGTTGCAGCCTA
GGTTCTATTCGATATCATCATCGCCCAAGTGAGTACCTTCATTGTCTTGGTCTTTTTGTC
TTCAAGTTGTTCGCTTGAGACTTATATTGTGTTTTTAGTGTATTGAGCATTGTCCCGTTT
ACTTGTATAGGATTGCTGAAACTAGAATTCACGTCACATGTGCACTGGTTTATGAGAAAA
TGCCAACTGGCAGGATTCATAAGGGAGTGTGTTCCACTTGGATGAAGGTAAATATAAAAA
ACTTAAATCTGATAGCTTCTTGCAAACATATTGCTTTGGAATCTTTTTACTGTTTGTGTC
ATTTCTTATCCATTGTCTTGGTGTTTTTGCTGGGTACTGATTTTTTGCATCGTAATCACA
GAATGCTGTGCCTTACGAGAAGAGTGAAAACTGTTCCTCGGCGCCGATATTTGTTAGGCA
ATCCAACTTCAAGCTTCCTTCTGATTCTAAGGTACCGATCATCATGATCGGTCCAGGGAC
TGGATTAGCTCCATTCAGAGGATTCCTTCAGGAAAGACTAGCGTTGGTAGAATCTGGTGT
TGAACTTGGGCCATCAGTTTTGTTCTTTGGATGCAGAAACCGTAGAATGGTAATAAAGCC
ATTACTCAAAACTCAAACCTTTCATTGGTTTTGTCCAGTTTCTAATCATATCTTCTCATA
TATGTAGGATTTCATCTACGAGGAAGAGCTCCAGCGATTTGTTGAGAGTGGTGCTCTCGC
AGAGCTAAGTGTCGCCTTCTCTCGTGAAGGACCCACCAAAGAATACGTACAGCACAAGAT
GATGGACAAGGTATGAGCTTATAGAAACCCAAAACTCAGATCTTCATATAGATTCAAATT
CAGATTCTTGAGCTGACAATCTTTCTGCAATGCAGGCTTCTGATATCTGGAATATGATCT
CTCAAGGAGCTTATTTATATGTTTGTGGTGACGCCAAAGGCATGGCAAGAGATGTTCACA
GATCTCTCCACACAATAGCTCAAGAACAGGTATGTCTTGTTGAGATCAATCTAGCATTAT
CATTGTCCGTATCACAAACCGACTCTAATGAGTTTATTTCTGTCTGTCTTGTTTTCAGGG
GTCAATGGATTCAACTAAAGCAGAGGGCTTCGTGAAGAATCTGCAAACGAGTGGAAGATA
TCTTAGAGATGTATGGTAA

===cDNAs===

Deduced from genomic sequence:

ATGTCCTCTTCTTCTTCTTCGTCAACCTCCATGATCGATCTCATGGCAGCAATCATCAAA
GGAGAGCCTGTAATTGTCTCCGACCCAGCTAATGCCTCCGCTTACGAGTCCGTAGCTGCT
GAATTATCCTCTATGCTTATAGAGAATCGTCAATTCGCCATGATTGTTACCACTTCCATT
GCTGTTCTTATTGGTTGCATCGTTATGCTCGTTTGGAGGAGATCCGGTTCTGGGAATTCA
AAACGTGTCGAGCCTCTTAAGCCTTTGGTTATTAAGCCTCGTGAGGAAGAGATTGATGAT
GGGCGTAAGAAAGTTACCATCTTTTTCGGTACACAAACTGGTACTGCTGAAGGTTTTGCA
AAGGCTTTAGGAGAAGAAGCTAAAGCAAGATATGAAAAGACCAGATTCAAAATCGTTGAT
TTGGATGATTACGCGGCTGATGATGATGAGTATGAGGAGAAATTGAAGAAAGAGGATGTG
GCTTTCTTCTTCTTAGCCACGTTAGTTTTCTTAGCTGATCTTTTGTTTGGGATCGGTATA
AGTATTAAATTTGATTTGTTCTTGTGGCTGACTTGGTTTTACTATCTGGAATCTGGATGT
AGATATGGAGATGGTGAGCCTACCGACAATGCAGCGAGATTCTACAAATGGTTCACCGAG
GGGAATGACAGAGGAGAATGGCTTAAGAACTTGAAGTATGGAGTGTTTGGATTAGGAAAC
AGACAATATGAGCATTTTAATAAGGTTGCCAAAGTTGTAGATGACATTCTTGTCGAACAA
GGTGCACAGCGTCTTGTACAAGTTGGTCTTGGAGATGATGACCAGTGTATTGAAGATGAC
TTTACCGCTTGGCGAGAAGCATTGTGGCCCGAGCTTGATACAATACTGAGGGAAGAAGGG
GATACAGCTGTTGCCACACCATACACTGCAGCTGTGTTAGAATACAGAGTTTCTATTCAC
GACTCTGAAGATGCCAAATTCAATGATATAAACATGGCAAATGGGAATGGTTACACTGTG
TTTGATGCTCAACATCCTTACAAAGCAAATGTCGCTGTTAAAAGGGAGCTTCATACTCCC
GAGTCTGATCGTTCTTGTATCCATTTGGAATTTGACATTGCTGGAAGTGGACTTACGTAT
GAAACTGGAGATCATGTTGGTGTACTTTGTGATAACTTAAGTGAAACTGTAGATGAAGCT
CTTAGATTGCTGGATATGTCACCTGATACTTATTTCTCACTTCACGCTGAAAAAGAAGAC
GGCACACCAATCAGCAGCTCACTGCCTCCTCCCTTCCCACCTTGCAACTTGAGAACAGCG
CTTACACGATATGCATGTCTTTTGAGTTCTCCAAAGAAGTCTGCTTTAGTTGCGTTGGCT
GCTCATGCATCTGATCCTACCGAAGCAGAACGATTAAAACACCTTGCTTCACCTGCTGGA
AAGGATGAATATTCAAAGTGGGTAGTAGAGAGTCAAAGAAGTCTACTTGAGGTGATGGCC
GAGTTTCCTTCAGCCAAGCCACCACTTGGTGTCTTCTTCGCTGGAGTTGCTCCAAGGTTG
CAGCCTAGGTTCTATTCGATATCATCATCGCCCAAGATTGCTGAAACTAGAATTCACGTC
ACATGTGCACTGGTTTATGAGAAAATGCCAACTGGCAGGATTCATAAGGGAGTGTGTTCC
ACTTGGATGAAGAATGCTGTGCCTTACGAGAAGAGTGAAAACTGTTCCTCGGCGCCGATA
TTTGTTAGGCAATCCAACTTCAAGCTTCCTTCTGATTCTAAGGTACCGATCATCATGATC
GGTCCAGGGACTGGATTAGCTCCATTCAGAGGATTCCTTCAGGAAAGACTAGCGTTGGTA
GAATCTGGTGTTGAACTTGGGCCATCAGTTTTGTTCTTTGGATGCAGAAACCGTAGAATG
GATTTCATCTACGAGGAAGAGCTCCAGCGATTTGTTGAGAGTGGTGCTCTCGCAGAGCTA
AGTGTCGCCTTCTCTCGTGAAGGACCCACCAAAGAATACGTACAGCACAAGATGATGGAC
AAGGCTTCTGATATCTGGAATATGATCTCTCAAGGAGCTTATTTATATGTTTGTGGTGAC
GCCAAAGGCATGGCAAGAGATGTTCACAGATCTCTCCACACAATAGCTCAAGAACAGGGG
TCAATGGATTCAACTAAAGCAGAGGGCTTCGTGAAGAATCTGCAAACGAGTGGAAGATAT
CTTAGAGATGTATGGTAA

GenBank Accession: X66017

===ESTs===

GenBank Accession: AV523825, AV544567, BE844735, AV538942, AV536671,
AV529580, AV522409, AV562632, AI998551, AV528901


Reductase position on Chromosome 4.


Go back to the list of P450-related genes.